Active Recombinant Human FOXA3(T58A) protein, Arginine-tagged
Cat.No. : | FOXA3-151H |
Product Overview : | Recombinant human cMyc (T58A mutant) protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | Arginine |
Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
Bio-activity : | 1. DNA binding activity was demonstrated using cMyc specific DNA binding oligo derived ELISA.2. Mouse iPS generation activity was measured for each lot of products. |
AA Sequence : | MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLP(T to A)PPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCAESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for PiPs application in vitro.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | FOXA3 forkhead box A3 [ Homo sapiens ] |
Official Symbol | FOXA3 |
Synonyms | FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma , HNF3G; hepatocyte nuclear factor 3-gamma; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; transcription factor 3G; FKHH3; HNF3G; TCF3G; MGC10179; |
Gene ID | 3171 |
mRNA Refseq | NM_004497 |
Protein Refseq | NP_004488 |
MIM | 602295 |
UniProt ID | P55318 |
Chromosome Location | 19q13.2-q13.4 |
Pathway | Developmental Biology, organism-specific biosystem; FOXA transcription factor networks, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; |
Function | DNA binding, bending; double-stranded DNA binding; protein domain specific binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; transcription regulatory region DNA binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FOXA3 Products
Required fields are marked with *
My Review for All FOXA3 Products
Required fields are marked with *
0
Inquiry Basket