Active Recombinant Human FOXA3(T58A) protein, Arginine-tagged

Cat.No. : FOXA3-151H
Product Overview : Recombinant human cMyc (T58A mutant) protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity : 1. DNA binding activity was demonstrated using cMyc specific DNA binding oligo derived ELISA.2. Mouse iPS generation activity was measured for each lot of products.
AA Sequence : MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLP(T to A)PPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCAESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for PiPs application in vitro.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name FOXA3 forkhead box A3 [ Homo sapiens ]
Official Symbol FOXA3
Synonyms FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma , HNF3G; hepatocyte nuclear factor 3-gamma; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; transcription factor 3G; FKHH3; HNF3G; TCF3G; MGC10179;
Gene ID 3171
mRNA Refseq NM_004497
Protein Refseq NP_004488
MIM 602295
UniProt ID P55318
Chromosome Location 19q13.2-q13.4
Pathway Developmental Biology, organism-specific biosystem; FOXA transcription factor networks, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem;
Function DNA binding, bending; double-stranded DNA binding; protein domain specific binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FOXA3 Products

Required fields are marked with *

My Review for All FOXA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon