Recombinant Human FOLR1 protein, GST-tagged

• Cat.No.: FOLR1-301148H
• Product Overview: Recombinant Human FOLR1 (55-93 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Glu55-Ala93
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: FOLR1 folate receptor 1 (adult) [ Homo sapiens ]
• Official Symbol: FOLR1
• Synonyms: FOLR1; folate receptor 1 (adult); FOLR; folate receptor alpha; FR-alpha; KB cells FBP; folate binding protein; folate receptor, adult; adult folate-binding protein; ovarian tumor-associated antigen MOv18; FBP
• Gene ID: 2348
• mRNA Refseq: NM_000802
• Protein Refseq: NP_000793
• MIM: 136430
• UniProt ID: P15328