Recombinant Mouse FOLR1 Protein, His-tagged

• Cat.No.: FOLR1-253M
• Product Overview: Recombinant Mouse FOLR1 protein with His tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 255
• Description: Predicted to enable carboxylic acid binding activity; folic acid receptor activity; and signaling receptor activity. Involved in circulatory system development; nervous system development; and regulation of signal transduction. Acts upstream of or within folic acid metabolic process. Predicted to be located in several cellular components, including apical plasma membrane; basolateral plasma membrane; and brush border membrane. Predicted to be anchored component of plasma membrane. Predicted to be anchored component of external side of plasma membrane. Is expressed in several structures, including brain; early conceptus; genitourinary system; gut; and retina. Human ortholog(s) of this gene implicated in cerebral folate receptor alpha deficiency. Orthologous to human FOLR1 (folate receptor alpha).
• Form: Lyophilized
• Molecular Mass: 26.2 kDa
• AA Sequence: MAHLMTVQLLLLVMWMAECAQSRATRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGFHGTWPLLCSLSLVLLWVIS
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Folr1 folate receptor 1 (adult) [ Mus musculus (house mouse) ]
• Official Symbol: FOLR1
• Synonyms: FOLR1; folate receptor 1 (adult); folate receptor alpha; FR-alpha; folate binding protein 1; folate-binding protein 1; FBP1; Folbp1; Folbp-1
• Gene ID: 14275
• mRNA Refseq: NM_001252552
• Protein Refseq: NP_001239481
• UniProt ID: P35846