Recombinant Human FNDC1 Protein, GST-tagged

• Cat.No.: FNDC1-4406H
• Product Overview: Human FNDC1 partial ORF ( XP_027658.3, 86 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FNDC1 (Fibronectin Type III Domain Containing 1) is a Protein Coding gene. Diseases associated with FNDC1 include Prostate Leiomyosarcoma. An important paralog of this gene is ABI3BP.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: VPSRLPPRSAATVSPVAGTHPWPQYTTRAPPGHFSTTPMLSLRQRMMHARFRNPLSRQPARPSYRQGYNGRPNVEGKVLPGSNGKPNGQRIINGPQGTK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FNDC1 fibronectin type III domain containing 1 [ Homo sapiens ]
• Official Symbol: FNDC1
• Synonyms: AGS8; FNDC2; MEL4B3; bA243O10.1; dJ322A24.1; RP11-243O10.2
• Gene ID: 84624
• mRNA Refseq: NM_032532
• Protein Refseq: NP_115921
• MIM: 609991
• UniProt ID: Q4ZHG4