Recombinant Human FLT3LG, StrepII-tagged

• Cat.No.: FLT3LG-254H
• Product Overview: Purified, full-length human recombinant FLT3L or Fms-related tyrosine kinase 3 ligand protein (amino acids 27-235, 209 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 23.7 kDa. (Accession NP_001450; UniProt P49771)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 27-235, 209 a.a.
• Description: Flt3L, a homodimer, stimulates the proliferation of early hematopoietic cells by activating FLT3. It synergizes well with a number of other colony stimulating factors and interleukins.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRF VQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQD LLLVE
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >90% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ]
• Official Symbol: FLT3LG
• Synonyms: FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L
• Gene ID: 2323
• mRNA Refseq: NM_001204502
• Protein Refseq: NP_001191431
• MIM: 600007
• UniProt ID: P49771
• Chromosome Location: 19q13.3
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Pathways in cancer, organism-specific biosystem
• Function: cytokine activity; protein homodimerization activity; receptor binding; receptor tyrosine kinase binding