Recombinant Human FLT3LG

Cat.No. : FLT3LG-28905TH
Product Overview : Recombinant full length extracellular domain of Human Flt3 Ligand protein expressed in modified Human 293 cells, amino acids 27-184.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 27-184 a.a.
Description : Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al.
Biological activity : Activity:The ED50 of FLT3LG-28905TH is typically between 0.5 -5.0 ng/ml as measured in a cell proliferation assay using the OCI/AML5 Human leukemia cell line.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical Sequence:TQDCSFQHSPISSDFAVKIRELSDYLLQD YPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSK MQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQE TSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSP RPLEATAPTAPAS
Full Length : Full L.
Gene Name FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ]
Official Symbol FLT3LG
Synonyms FLT3LG; fms-related tyrosine kinase 3 ligand;
Gene ID 2323
mRNA Refseq NM_001204502
Protein Refseq NP_001191431
MIM 600007
Uniprot ID P49771
Chromosome Location 19q13.3
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function cytokine activity; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FLT3LG Products

Required fields are marked with *

My Review for All FLT3LG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon