Active Recombinant Human FLT3L protein
| Cat.No. : | FLT3LG-25H |
| Product Overview : | Recombinant Human FLT3L (27–181 of P49771-1 FLT3L_HUMAN) protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | Nicotiana benthamiana |
| Species : | Human |
| Form : | Lyophilized from a Tris HCl 0.05M buffer pH 7.4. |
| Bio-activity : | The activity of Flt-3 is determinated by the dose-dependent stimulation of the proliferation of human acute myeloid leukemia cells (OCMI-AML5). ED50 is typically ≤ 1 ng/ml. |
| Molecular Mass : | It has a predicted molecular mass of 18.4 kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 18-25 kDa in SDS-PAGE. |
| AA Sequence : | HHHHHHTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQ GLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWS PRPLEATAPTA |
| Endotoxin : | 1 EU/µg determined by LAL method |
| Purity : | >95 % as determined by SDS-PAGE analysis |
| Applications : | BIOASSAY, SDS-PAGE, WB. |
| Storage : | Frozen / Solution. For extended storage, conserve at −80ºC. Repeated freezing and thawing is not recommended. Store working aliquots at 4ºC for up to one week. |
| Reconstitution : | Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines. |
| Tag : | Non |
| Protein length : | 28-181 a.a. |
| Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ] |
| Official Symbol | FLT3LG |
| Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; FL; Flt3 ligand |
| Gene ID | 2323 |
| mRNA Refseq | NM_001459 |
| Protein Refseq | NP_001450 |
| MIM | 600007 |
| UniProt ID | P49771 |
| Chromosome Location | 19q13.3 |
| Pathway | Cytokine-cytokine receptor interaction; atopoietic cell lineage; Pathways in cancer |
| Function | cytokine activity; protein homodimerization activity; receptor tyrosine kinase binding |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
0
Inquiry Basket
