Recombinant Human FKBP5, GST-tagged

• Cat.No.: FKBP5-214H
• Product Overview: Recombinant Human FKBP5(1 a.a. - 457 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 76.01 kDa
• AA Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNE PFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIR RTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGF GEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE KVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEE EKPEGHV
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FKBP5 FK506 binding protein 5 [ Homo sapiens ]
• Official Symbol: FKBP5
• Synonyms: FKBP5; FK506 binding protein 5; P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10; MGC111006; peptidyl-prolyl cis-trans isomerase FKBP5; FKBP-5; FKBP-51; rotamase; 51 kDa FKBP; FF1 antigen; PPIase FKBP5; HSP90-binding immunophilin; T-cell FK506-binding protein; androgen-regulated protein 6; 51 kDa FK506-binding protein 5; peptidylprolyl cis-trans isomerase; 54 kDa progesterone receptor-associated immunophilin; EC 5.2.1.8; PPIase FKBP5; OTTHUMP00000016268
• Gene ID: 2289
• mRNA Refseq: NM_001145775
• Protein Refseq: NP_001139247
• MIM: 602623
• UniProt ID: Q13451
• Chromosome Location: 6p21.31
• Pathway: Estrogen signaling pathway; Glucocorticoid receptor regulatory network; TNF-alpha/NF-kB Signaling Pathway
• Function: FK506 binding; heat shock protein binding; peptidyl-prolyl cis-trans isomerase activity