Recombinant Full Length Human FKBP5 Protein, GST-tagged

Cat.No. : FKBP5-6932HF
Product Overview : Recombinant Human full-length FKBP5(1 a.a. - 457 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 457 amino acids
Description : The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.
Molecular Mass : 76.01 kDa
AA Sequence : MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNE PFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIR RTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGF GEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE KVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEE EKPEGHV
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FKBP5 FKBP prolyl isomerase 5 [ Homo sapiens (human) ]
Official Symbol FKBP5
Synonyms FKBP5; FK506 binding protein 5; P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10; MGC111006; peptidyl-prolyl cis-trans isomerase FKBP5; FKBP-5; FKBP-51; rotamase; 51 kDa FKBP; FF1 antigen; PPIase FKBP5; HSP90-binding immunophilin; T-cell FK506-binding protein; androgen-regulated protein 6; 51 kDa FK506-binding protein 5; peptidylprolyl cis-trans isomerase; 54 kDa progesterone receptor-associated immunophilin; EC 5.2.1.8; PPIase FKBP5; OTTHUMP00000016268
Gene ID 2289
mRNA Refseq NM_001145775
Protein Refseq NP_001139247
MIM 602623
UniProt ID Q13451

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FKBP5 Products

Required fields are marked with *

My Review for All FKBP5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon