Recombinant Human FKBP3 Protein, His-tagged
Cat.No. : | FKBP3-795H |
Product Overview : | Recombinant Human FKBP3 fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM TrisHCl, 1mM DTT, 10%glycerol, pH8.0 |
Molecular Mass : | 27.3kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ] |
Official Symbol | FKBP3 |
Synonyms | FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; rotamase; 25 kDa FKBP; PPIase FKBP3; immunophilin FKBP25; rapamycin binding protein; 25 kDa FK506-binding protein; FK506-binding protein 3 (25kD); FK506-binding protein 25, T-cell; rapamycin-selective 25 kDa immunophilin; FKBP-3; FKBP25; FKBP-25; |
Gene ID | 2287 |
mRNA Refseq | NM_002013 |
Protein Refseq | NP_002004 |
MIM | 186947 |
UniProt ID | Q00688 |
◆ Recombinant Proteins | ||
FKBP3-2954H | Recombinant Human FKBP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fkbp3-1266M | Recombinant Mouse Fkbp3 protein, His-tagged | +Inquiry |
FKBP3-2921H | Recombinant Human FKBP3 protein, His-SUMO-tagged | +Inquiry |
FKBP3-2188C | Recombinant Cattle FKBP3 Protein, His-tagged | +Inquiry |
FKBP3-28915TH | Recombinant Human FKBP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP3-6206HCL | Recombinant Human FKBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FKBP3 Products
Required fields are marked with *
My Review for All FKBP3 Products
Required fields are marked with *
0
Inquiry Basket