Recombinant Human FKBP3

• Cat.No.: FKBP3-28915TH
• Product Overview: Recombinant full length Human FKBP25; amino acids 1-224, Predicted mwt: 25 kDa

Specification

• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAE HKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISK VSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAK PSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKK GQPDAKIPPNAKLTFEVELVDID
• Tag: Non
• Protein length: 1-224 a.a.
• Full Length: Full L.

Gene Information

• Gene Name: FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
• Official Symbol: FKBP3
• Synonyms: FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase
• Gene ID: 2287
• mRNA Refseq: NM_002013
• Protein Refseq: NP_002004
• MIM: 186947
• Uniprot ID: Q00688
• Chromosome Location: 14q21.2
• Pathway: Signaling events mediated by HDAC Class I, organism-specific biosystem
• Function: FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; receptor activity