Recombinant Human FKBP3 Protein, GST-tagged

Cat.No. : FKBP3-4190H
Product Overview : Human FKBP3 full-length ORF ( AAH16288, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq
Molecular Mass : 50.38 kDa
AA Sequence : MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKEKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
Official Symbol FKBP3
Synonyms FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; rotamase; 25 kDa FKBP; PPIase FKBP3; immunophilin FKBP25; rapamycin binding protein; 25 kDa FK506-binding protein; FK506-binding protein 3 (25kD); FK506-binding protein 25, T-cell; rapamycin-selective 25 kDa immunophilin; FKBP-3; FKBP25; FKBP-25;
Gene ID 2287
mRNA Refseq NM_002013
Protein Refseq NP_002004
MIM 186947
UniProt ID Q00688

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FKBP3 Products

Required fields are marked with *

My Review for All FKBP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon