Recombinant Human FKBP1B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FKBP1B-1346H
• Product Overview: FKBP1B MS Standard C13 and N15-labeled recombinant protein (NP_473374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 8.8 kDa
• AA Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FKBP1B FKBP prolyl isomerase 1B [ Homo sapiens (human) ]
• Official Symbol: FKBP1B
• Synonyms: FKBP1B; FK506 binding protein 1B, 12.6 kDa; FK506 binding protein 1B (12.6 kD), FKBP1L; peptidyl-prolyl cis-trans isomerase FKBP1B; FKBP9; FKBP12.6; OTK4; PPIase; FKBP-1B; rotamase; FKBP-12.6; h-FKBP-12; calstabin 2; 12.6 kDa FKBP; PPIase FKBP1B; immunophilin FKBP12.6; FK506-binding protein 1B; FK506-binding protein 12.6; 12.6 kDa FK506-binding protein; FKBP1L; PKBP1L
• Gene ID: 2281
• mRNA Refseq: NM_054033
• Protein Refseq: NP_473374
• MIM: 600620
• UniProt ID: P68106