Recombinant Human FKBP1B Protein, GST-tagged
Cat.No. : | FKBP1B-4187H |
Product Overview : | Human FKBP1B full-length ORF ( AAH02614, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq |
Molecular Mass : | 34.54 kDa |
AA Sequence : | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP1B FK506 binding protein 1B, 12.6 kDa [ Homo sapiens ] |
Official Symbol | FKBP1B |
Synonyms | FKBP1B; FK506 binding protein 1B, 12.6 kDa; FK506 binding protein 1B (12.6 kD), FKBP1L; peptidyl-prolyl cis-trans isomerase FKBP1B; FKBP9; FKBP12.6; OTK4; PPIase; FKBP-1B; rotamase; FKBP-12.6; h-FKBP-12; calstabin 2; 12.6 kDa FKBP; PPIase FKBP1B; immunophilin FKBP12.6; FK506-binding protein 1B; FK506-binding protein 12.6; 12.6 kDa FK506-binding protein; FKBP1L; PKBP1L; |
Gene ID | 2281 |
mRNA Refseq | NM_004116 |
Protein Refseq | NP_004107 |
MIM | 600620 |
UniProt ID | P68106 |
◆ Recombinant Proteins | ||
FKBP1B-2500H | Active Recombinant Human FK506 Binding Protein 1B, 12.6 KDa, His-tagged | +Inquiry |
FKBP1B-1719R | Recombinant Rhesus monkey FKBP1B Protein, His-tagged | +Inquiry |
FKBP1B-5252H | Recombinant Human FKBP1B Protein | +Inquiry |
FKBP1B-28914TH | Recombinant Human FKBP1B, His-tagged | +Inquiry |
FKBP1B-1541R | Recombinant Rhesus Macaque FKBP1B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP1B-6209HCL | Recombinant Human FKBP1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FKBP1B Products
Required fields are marked with *
My Review for All FKBP1B Products
Required fields are marked with *
0
Inquiry Basket