Recombinant Human FKBP1B Protein, GST-tagged

• Cat.No.: FKBP1B-4187H
• Product Overview: Human FKBP1B full-length ORF ( AAH02614, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.54 kDa
• AA Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FKBP1B FK506 binding protein 1B, 12.6 kDa [ Homo sapiens ]
• Official Symbol: FKBP1B
• Synonyms: FKBP1B; FK506 binding protein 1B, 12.6 kDa; FK506 binding protein 1B (12.6 kD), FKBP1L; peptidyl-prolyl cis-trans isomerase FKBP1B; FKBP9; FKBP12.6; OTK4; PPIase; FKBP-1B; rotamase; FKBP-12.6; h-FKBP-12; calstabin 2; 12.6 kDa FKBP; PPIase FKBP1B; immunophilin FKBP12.6; FK506-binding protein 1B; FK506-binding protein 12.6; 12.6 kDa FK506-binding protein; FKBP1L; PKBP1L
• Gene ID: 2281
• mRNA Refseq: NM_004116
• Protein Refseq: NP_004107
• MIM: 600620
• UniProt ID: P68106