Recombinant Human FKBP1B, His-tagged
| Cat.No. : | FKBP1B-28914TH |
| Product Overview : | Recombinant full-length Human FKBP1B with a N terminal His tag. 130 amino acids with a predicted MWt 14.2 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. |
| Protein length : | 108 amino acids |
| Conjugation : | HIS |
| Molecular Weight : | 14.200kDa inclusive of tags |
| Source : | E. coli |
| Tissue specificity : | Isoform 1 and isoform 2 are Ubiquitous with highest levels in brain and thymus. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHRSMGVEIETISPGDGRTFPK KGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIK GFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATL IFDVELLNLE |
| Sequence Similarities : | Belongs to the FKBP-type PPIase family. FKBP1 subfamily.Contains 1 PPIase FKBP-type domain. |
| Gene Name | FKBP1B FK506 binding protein 1B, 12.6 kDa [ Homo sapiens ] |
| Official Symbol | FKBP1B |
| Synonyms | FKBP1B; FK506 binding protein 1B, 12.6 kDa; FK506 binding protein 1B (12.6 kD) , FKBP1L; peptidyl-prolyl cis-trans isomerase FKBP1B; FKBP9; FKBP12.6; OTK4; PPIase; |
| Gene ID | 2281 |
| mRNA Refseq | NM_004116 |
| Protein Refseq | NP_004107 |
| MIM | 600620 |
| Uniprot ID | P68106 |
| Chromosome Location | 2p23.3 |
| Function | FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; receptor binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FKBP1B Products
Required fields are marked with *
My Review for All FKBP1B Products
Required fields are marked with *
0
Inquiry Basket
