Recombinant Human FHIT Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FHIT-715H
• Product Overview: FHIT MS Standard C13 and N15-labeled recombinant protein (NP_002003) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 16.9 kDa
• AA Sequence: MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FHIT fragile histidine triad [ Homo sapiens (human) ]
• Official Symbol: FHIT
• Synonyms: FHIT; fragile histidine triad; fragile histidine triad gene; bis(5-adenosyl)-triphosphatase; AP3Aase; FRA3B; AP3A hydrolase; tumor suppressor protein; dinucleosidetriphosphatase; diadenosine 5,5-P1,P3-triphosphate hydrolase
• Gene ID: 2272
• mRNA Refseq: NM_002012
• Protein Refseq: NP_002003
• MIM: 601153
• UniProt ID: P49789