Recombinant Human FGL1 Protein, GST-tagged

• Cat.No.: FGL1-4152H
• Product Overview: Human FGL1 full-length ORF ( AAH07047, 19 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 57.97 kDa
• AA Sequence: EISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FGL1 fibrinogen-like 1 [ Homo sapiens ]
• Official Symbol: FGL1
• Synonyms: FGL1; fibrinogen-like 1; fibrinogen-like protein 1; HFREP 1; hepassocin; liver fibrinogen-related protein 1; hepatocellular carcinoma-related sequence; hepatocyte-derived fibrinogen-related protein 1; HFREP1; HP-041; LFIRE1; LFIRE-1; MGC12455
• Gene ID: 2267
• mRNA Refseq: NM_004467
• Protein Refseq: NP_004458
• MIM: 605776
• UniProt ID: Q08830