Recombinant Human FGFBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FGFBP2-5684H
• Product Overview: FGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114156) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 24.6 kDa
• AA Sequence: MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FGFBP2 fibroblast growth factor binding protein 2 [ Homo sapiens (human) ]
• Official Symbol: FGFBP2
• Synonyms: FGFBP2; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; killer specific secretory protein of 37 kDa; KSP37; FGF-BP2; FGFBP-2; HBp17-RP; FGF-binding protein 2; HBp17-related protein; 37 kDa killer-specific secretory protein; killer-specific secretory protein of 37 kDa; HBP17RP
• Gene ID: 83888
• mRNA Refseq: NM_031950
• Protein Refseq: NP_114156
• MIM: 607713
• UniProt ID: Q9BYJ0