Recombinant Human FGF9 protein
Cat.No. : | FGF9-107H |
Product Overview : | Recombinant Human FGF9 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 207 |
Description : | Fibroblast growth factor-9 (FGF-9) is a member of the fibroblast growth factor (FGF) family. All FGF family members are heparin binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. FGF-9 is a monomer and interacts with FGFR1, FGFR2, FGFR3 and FGFR4. The human FGF-9 shares 98 % a.a. sequence identity with mouse, rat, equine, porcine, and bovine FGF-9. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 23.3 kDa, a single non-glycosylated polypeptide chain containing 207 amino acids. |
AA Sequence : | APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Endotoxin : | Less than 1 EU/µg of rHuFGF-9 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 1 × PBS to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FGF9 |
Official Symbol | FGF9 |
Synonyms | FGF9; fibroblast growth factor 9 (glia-activating factor); fibroblast growth factor 9; FGF-9; HBGF-9; heparin-binding growth factor 9; GAF; SYNS3; HBFG-9; MGC119914; MGC119915; |
Gene ID | 2254 |
mRNA Refseq | NM_002010 |
Protein Refseq | NP_002001 |
MIM | 600921 |
UniProt ID | P31371 |
◆ Recombinant Proteins | ||
FGF9-4117H | Recombinant Human FGF9 Protein, GST-tagged | +Inquiry |
Fgf9-405F | Active Recombinant Mouse Fgf9 Protein (207 aa) | +Inquiry |
Fgf9-188R | Recombinant Rat Fgf9 protein, His/S-tagged | +Inquiry |
Fgf9-286F | Active Recombinant Mouse Fgf9 Protein | +Inquiry |
FGF9-96R | Recombinant Rat FGF9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF9-2955HCL | Recombinant Human FGF9 cell lysate | +Inquiry |
FGF9-001CCL | Recombinant Canine FGF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF9 Products
Required fields are marked with *
My Review for All FGF9 Products
Required fields are marked with *
0
Inquiry Basket