Active Recombinant Mouse Fgf9 Protein

• Cat.No.: Fgf9-286F
• Product Overview: Recombinant Mouse Fgf9 Protein without tag was expressed in CHO.

Specification

• Description: Fibroblast Growth Factor-9 (FGF-9), also known as Glia-activating factor (GAF) and HBGF-9, belongs to the heparin-binding growth factors family. It is a secreted protein that exists as monomer or homodimer. It interacts with FGFR-1, FGFR-2, FGFR-3, and FGFR-4 and plays an important role in regulating cell proliferation, differentiation and migration. It is reported that FGF-9 may be involved in glial cell growth and differentiation during development, gliosis during brain tissue regeneration, and glial tumor growth stimulation. Other reports indicate that FGF-9 plays a role in male development.
• Source: CHO
• Species: Mouse
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 2 ng/mL, measured in a cell proliferation assay using 3T3 cells.
• Molecular Mass: ~28 kDa, observed by reducing SDS-PAGE.
• AA Sequence: LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Murine Fibroblast Growth Factor-9 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Fibroblast Growth Factor-9should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Fgf9 fibroblast growth factor 9 [ Mus musculus ]
• Official Symbol: Fgf9
• Synonyms: FGF9; fibroblast growth factor 9; GAF; FGF-9; HBGF-9; elbow knee synostosis; glia activating factor; glia-activating factor; Eks
• Gene ID: 14180
• mRNA Refseq: NM_013518
• Protein Refseq: NP_038546
• UniProt ID: P54130