Recombinant Human FGF23 Full Length Protein, His tagged
Cat.No. : | FGF23-3586H |
Product Overview : | Recombinant Human FGF23 protein(Tyr25-Ile251), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Tyr25-Ile251 |
Tag : | C-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 28 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
UniProt ID-Weblink : | http://www.uniprot.org/uniprot/ |
AA Sequence : | YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIGGGSGGGSHHHHHHHHHH |
Gene Name | FGF23 fibroblast growth factor 23 [ Homo sapiens ] |
Official Symbol | FGF23 |
Synonyms | FGF23; fibroblast growth factor 23; |
Gene ID | 53406 |
◆ Recombinant Proteins | ||
FGF23-4824HF | Recombinant Full Length Human FGF23 Protein, GST-tagged | +Inquiry |
FGF23-3589H | Recombinant Human FGF23 Protein (Ser180-Ile251), N-His tagged | +Inquiry |
FGF23-4112H | Recombinant Human FGF23 Protein, GST-tagged | +Inquiry |
FGF23-416H | Recombinant Human Fibroblast Growth Factor 23, Fc Chimera | +Inquiry |
Fgf23-835M | Recombinant Mouse Fgf23 protein(Tyr25~Val251), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF23-6241HCL | Recombinant Human FGF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF23 Products
Required fields are marked with *
My Review for All FGF23 Products
Required fields are marked with *
0
Inquiry Basket