Recombinant Full Length Human FGF23 Protein, GST-tagged
Cat.No. : | FGF23-4824HF |
Product Overview : | Human FGF23 full-length ORF (NP_065689.1, 1 a.a. - 251 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 251 amino acids |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The product of this gene inhibits renal tubular phosphate transport. This gene was identified by its mutations associated with autosomal dominant hypophosphatemic rickets (ADHR), an inherited phosphate wasting disorder. Abnormally high level expression of this gene was found in oncogenic hypophosphatemic osteomalacia (OHO), a phenotypically similar disease caused by abnormal phosphate metabolism. Mutations in this gene have also been shown to cause familial tumoral calcinosis with hyperphosphatemia. [provided by RefSeq |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGF23 fibroblast growth factor 23 [ Homo sapiens ] |
Official Symbol | FGF23 |
Synonyms | FGF23; fibroblast growth factor 23; |
Gene ID | 8074 |
mRNA Refseq | NM_020638 |
Protein Refseq | NP_065689 |
MIM | 605380 |
UniProt ID | Q9GZV9 |
◆ Recombinant Proteins | ||
Fgf23-7408M | Active Recombinant Mouse Fgf23 Protein | +Inquiry |
FGF23-2333R | Recombinant Rat FGF23 Protein | +Inquiry |
FGF23-1014H | Recombinant Human FGF23 Protein (Y25-R179), His tagged | +Inquiry |
FGF23-3431H | Recombinant Human FGF23 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FGF23-1990R | Recombinant Rat FGF23 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF23-6241HCL | Recombinant Human FGF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF23 Products
Required fields are marked with *
My Review for All FGF23 Products
Required fields are marked with *
0
Inquiry Basket