Recombinant Human FGF22 Protein

• Cat.No.: FGF22-86H
• Product Overview: Recombinant Human FGF22 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Fibroblast growth factor 22 (FGF-22) is a mediator of synaptogenesis in the adult nervous system and functions to regulate synapse formation and maturation. FGF-22 is expressed in the inner hair cell and functions to maintain ribbon synapse number to protect functional hearing. In the hippocampus, FGF-22 promotes excitatory synapse formation through binding the FGFR2b and FGFR1b receptors. FGF-22 is also required for axonal circuit remodeling after spinal cord injury.
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 17.3 kDa (149 aa)
• AA Sequence: MTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: FGF22 fibroblast growth factor 22 [ Homo sapiens (human) ]
• Official Symbol: FGF22
• Synonyms: FGF22; fibroblast growth factor 22; FGF-22
• Gene ID: 27006
• mRNA Refseq: NM_020637
• Protein Refseq: NP_065688
• MIM: 605831
• UniProt ID: Q9HCT0