Recombinant Human FGF2 Protein

• Cat.No.: FGF2-133H
• Product Overview: Recombinant Human Fibroblast growth factor 2/Fibroblast Growth Factor Basic is produced by our E.coli expression system and the target gene encoding Pro143-Ser288 is expressed.

Specification

• Species: Human
• Source: E.coli
• Protein Length: Pro143-Ser288
• Description: FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells.
• Form: Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
• AA Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIK GVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTG PGQKAILFLPMSAKS
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100μg/ml.
  Dissolve the lyophilized protein in distilled water.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Purity: >95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: FGF2 fibroblast growth factor 2 [ Homo sapiens (human) ]
• Official Symbol: FGF2
• Synonyms: FGF-2; bFGF; FGFB; HBGF-2; BFGF; Fibroblast growth factor 2; Basic fibroblast growth factor; Heparin-binding growth factor 2
• Gene ID: 2247
• mRNA Refseq: NM_002006.6
• Protein Refseq: NP_001997.5
• MIM: 134920
• UniProt ID: P09038