Recombinant Human FGF1, StrepII-tagged

• Cat.No.: FGF1-244H
• Product Overview: Purified, full-length human recombinant FGF1 or Acidic fibroblast growth factor protein (amino acids 16-155, 140 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 15.8 kDa. (Accession NP_000791.1; UniProt P05230)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 16-155, 140 a.a.
• Description: FGF1 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.
• Form: Lyophilized from sterile 0.2|ìm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYI SKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20??C as supplied; 1 month at 4??C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ]
• Official Symbol: FGF1
• Synonyms: FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha
• Gene ID: 2246
• mRNA Refseq: NM_000800
• Protein Refseq: NP_000791
• MIM: 131220
• UniProt ID: P05230
• Chromosome Location: 5q31.3-q33.2
• Pathway: Downstream signaling of activated FGFR, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR1 ligand binding and activation, organism-specific biosystem; FGFR1b ligand binding and activation, organism-specific biosystem; FGFR1c ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem
• Function: S100 alpha binding; fibroblast growth factor receptor binding; growth factor activity; heparin binding; protein binding; protein tyrosine kinase activity