Recombinant Human FGF1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FGF1-5960H |
Product Overview : | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000791) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FGF1 fibroblast growth factor 1 [ Homo sapiens (human) ] |
Official Symbol | FGF1 |
Synonyms | FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha; |
Gene ID | 2246 |
mRNA Refseq | NM_000800 |
Protein Refseq | NP_000791 |
MIM | 131220 |
UniProt ID | P05230 |
◆ Recombinant Proteins | ||
FGF1-5231H | Recombinant Human FGF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FGF1-12H | Active Recombinant Human FGF1 Protein (Carry Free-Lyophilized, 140 amino acid) | +Inquiry |
FGF1-038H | Recombinant Human FGF1 Protein | +Inquiry |
FGF1-79M | Recombinant Mouse/Rat FGF1 Protein | +Inquiry |
FGF1-629S | Recombinant Sheep FGF1 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
FGF1-26203TH | Native Human FGF1 | +Inquiry |
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *
0
Inquiry Basket