Active Recombinant Human FGF1 Protein

• Cat.No.: FGF1-77H
• Product Overview: Recombinant Human FGF1 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Acidic fibroblast growth factor (FGF-acidic), also known as FGF-1, is a potent inducer of DNA synthesis, cell proliferation, and has chemotactic activities. FGF-acidic regulates cardiogenesis through protein kinase C signaling. FGF-acidic also functions as an insulin sensitizer and mediates adipose tissue remodeling. High serum levels of FGF-acidic are associated with type 2 diabetes mellitus (T2DM), suggesting a pathogenic role of FGF-acidic during T2DM.
• Bio-activity: 3T3 cell proliferation, ≤2 ng/mL; ≥5.0 x 10^5 units/mg
• Molecular Mass: Monomer, 16 kDa (141 aa)
• AA Sequence: MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 150 mM sodium sulfate, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens (human) ]
• Official Symbol: FGF1
• Synonyms: FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha
• Gene ID: 2246
• mRNA Refseq: NM_000800
• Protein Refseq: NP_000791
• MIM: 131220
• UniProt ID: P05230