Recombinant Human FCGRT Protein, GST-tagged

Cat.No. : FCGRT-3998H
Product Overview : Human FCGRT partial ORF ( AAH08734, 51 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Molecular Mass : 37.84 kDa
AA Sequence : GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ]
Official Symbol FCGRT
Synonyms FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain;
Gene ID 2217
mRNA Refseq NM_001136019
Protein Refseq NP_001129491
MIM 601437
UniProt ID P55899

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FCGRT Products

Required fields are marked with *

My Review for All FCGRT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon