Recombinant Human FCGRT Protein, GST-tagged

• Cat.No.: FCGRT-3998H
• Product Overview: Human FCGRT partial ORF ( AAH08734, 51 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ]
• Official Symbol: FCGRT
• Synonyms: FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain
• Gene ID: 2217
• mRNA Refseq: NM_001136019
• Protein Refseq: NP_001129491
• MIM: 601437
• UniProt ID: P55899