Recombinant Human FCGRT Protein, GST-tagged
Cat.No. : | FCGRT-1210H |
Product Overview : | Recombinant Human FCGRT Protein(24-297aa) was expressed in E. coli with N-terminal GST-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-297 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 57.4 kDa |
AA Sequence : | AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ] |
Official Symbol | FCGRT |
Synonyms | FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain |
Gene ID | 2217 |
mRNA Refseq | NM_001136019 |
Protein Refseq | NP_001129491 |
MIM | 601437 |
UniProt ID | P55899 |
◆ Recombinant Proteins | ||
FCGRT-7513R | Recombinant Rat FCGRT, His tagged | +Inquiry |
FCGRT-33H | Recombinant Human FCGRT Protein, Ala24-Ser297, C-6×His tagged | +Inquiry |
FCGRT-937H | Recombinant Human FCGRT Protein, His-Avi-tagged | +Inquiry |
FCGRT-2306R | Recombinant Rat FCGRT Protein | +Inquiry |
FCGRT-3057H | Recombinant Human FCGRT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGRT Products
Required fields are marked with *
My Review for All FCGRT Products
Required fields are marked with *
0
Inquiry Basket