Recombinant Human FCGRT Protein, GST-tagged

• Cat.No.: FCGRT-1210H
• Product Overview: Recombinant Human FCGRT Protein(24-297aa) was expressed in E. coli with N-terminal GST-tag.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 57.4 kDa
• AA Sequence: AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 24-297 a.a.

Gene Information

• Gene Name: FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ]
• Official Symbol: FCGRT
• Synonyms: FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain
• Gene ID: 2217
• mRNA Refseq: NM_001136019
• Protein Refseq: NP_001129491
• MIM: 601437
• UniProt ID: P55899