Recombinant Human FCGR3B Protein, Fc/His-tagged
Cat.No. : | FCGR3B-284H |
Product Overview : | Recombinant Human FCGR3B fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Description : | Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 49.3kD |
AA Sequence : | TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | FCGR3B Fc fragment of IgG, low affinity IIIb, receptor (CD16b) [ Homo sapiens ] |
Official Symbol | FCGR3B |
Synonyms | FCGR3B; Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc fragment of IgG, low affinity IIIb, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-B; CD16; CD16b; fc-gamma RIII; fc-gamma RIIIb; fc-gamma RIII-beta; igG Fc receptor III-1; Fc-gamma receptor IIIb (CD 16); Fc fragment of IgG, low affinity IIIb, receptor for (CD16); FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb; |
Gene ID | 2215 |
mRNA Refseq | NM_000570 |
Protein Refseq | NP_000561 |
MIM | 610665 |
UniProt ID | O75015 |
◆ Recombinant Proteins | ||
FCGR3B-2934H | Recombinant Human FCGR3B Protein, His (Fc)-Avi-tagged | +Inquiry |
FCGR3B-1253H | Recombinant Human FCGR3B Protein | +Inquiry |
FCGR3B-1473H | Recombinant Human FCGR3B Protein, His-tagged | +Inquiry |
FCGR3B-3869HB | Active Recombinant Human FCGR3B protein, Biotinylated | +Inquiry |
FCGR3B-284H | Recombinant Human FCGR3B Protein, Fc/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR3B-001HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
FCGR3B-3055HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGR3B Products
Required fields are marked with *
My Review for All FCGR3B Products
Required fields are marked with *
0
Inquiry Basket