Recombinant Human FCER2, StrepII-tagged

• Cat.No.: FCER2-238H
• Product Overview: Purified human recombinant CD23 or Low affinity immunoglobulin epsilon Fc protein (amino acids 48-321, 274 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 31 kDa. (Accession NP_001993.2; UniProt P06734)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 48-321, 274 a.a.
• Description: CD23 is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein is a single-pass type II membrane protein, but also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDL LERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVD GSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: ~90% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: FCER2 Fc fragment of IgE, low affinity II, receptor for (CD23) [ Homo sapiens ]
• Official Symbol: FCER2
• Synonyms: FCER2; Fc fragment of IgE, low affinity II, receptor for (CD23); CD23A, Fc fragment of IgE, low affinity II, receptor for (CD23A) , FCE2; low affinity immunoglobulin epsilon Fc receptor; CD23; CLEC4J; BLAST-2; CD23 antigen; fc-epsilon-RII; lymphocyte IgE receptor; immunoglobulin E-binding factor; C-type lectin domain family 4, member J; FCE2; CD23A; IGEBF
• Gene ID: 2208
• mRNA Refseq: NM_001207019
• Protein Refseq: NP_001193948
• MIM: 151445
• UniProt ID: P06734
• Chromosome Location: 19p13.3
• Pathway: Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; IL-3 Signaling Pathway, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem
• Function: IgE binding; binding; integrin binding; metal ion binding; receptor activity; sugar binding