Recombinant Human FBXW9 Protein, GST-tagged

Cat.No. : FBXW9-3978H
Product Overview : Human FBXW9 full-length ORF ( ENSP00000254324, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Molecular Mass : 40.7 kDa
AA Sequence : MTGTSSQAARTTPWWWWTAEPTASCSVCSWTPTCSACPTRNPSSGLVTTRACCTSSPTATAASSLSGPLMWATAFPSLGSSTPWEPCTPHPLTRPSGCTCPQTHQGPFAPEGMTMGSIGSVLRATWWWPALETCR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXW9 F-box and WD repeat domain containing 9 [ Homo sapiens ]
Official Symbol FBXW9
Synonyms FBXW9; F-box and WD repeat domain containing 9; F box and WD 40 domain protein 9; F-box/WD repeat-containing protein 9; Fbw9; MGC10870; F-box and WD-40 domain protein 9; F-box and WD-40 domain-containing protein 9; F-box and WD-40 repeat containing protein 9; specificity factor for SCF ubiquitin ligase;
Gene ID 84261
mRNA Refseq NM_032301
Protein Refseq NP_115677
MIM 609074
UniProt ID Q5XUX1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FBXW9 Products

Required fields are marked with *

My Review for All FBXW9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon