Recombinant Full Length Human FBXW9 Protein, GST-tagged

• Cat.No.: FBXW9-4727HF
• Product Overview: Human FBXW9 full-length ORF ( ENSP00000254324, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 135 amino acids
• Description: Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 40.7 kDa
• AA Sequence: MTGTSSQAARTTPWWWWTAEPTASCSVCSWTPTCSACPTRNPSSGLVTTRACCTSSPTATAASSLSGPLMWATAFPSLGSSTPWEPCTPHPLTRPSGCTCPQTHQGPFAPEGMTMGSIGSVLRATWWWPALETCR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXW9 F-box and WD repeat domain containing 9 [ Homo sapiens ]
• Official Symbol: FBXW9
• Synonyms: FBXW9; F-box and WD repeat domain containing 9; F box and WD 40 domain protein 9; F-box/WD repeat-containing protein 9; Fbw9; MGC10870; F-box and WD-40 domain protein 9; F-box and WD-40 domain-containing protein 9; F-box and WD-40 repeat containing protein 9; specificity factor for SCF ubiquitin ligase
• Gene ID: 84261
• mRNA Refseq: NM_032301
• Protein Refseq: NP_115677
• MIM: 609074
• UniProt ID: Q5XUX1