Recombinant Human FBXW7 protein, His-tagged

• Cat.No.: FBXW7-3173H
• Product Overview: Recombinant Human FBXW7 protein(1-227 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-227 aa
• AA Sequence: MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FBXW7 F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: FBXW7
• Synonyms: FBXW7; F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase; F box and WD repeat domain containing 7 , F box and WD 40 domain protein 7 (archipelago homolog, Drosophila); F-box/WD repeat-containing protein 7; AGO; archipelago homolog (Drosophila); CDC4; FBW7; FBX30; FBXW6; FLJ11071; SEL 10; SEL10; archipelago; F-box protein FBW7; F-box protein FBX30; F-box protein SEL-10; homolog of C elegans sel-10; F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila); FBW6; hAgo; hCdc4; FBXO30; SEL-10; FLJ16457; DKFZp686F23254
• Gene ID: 55294
• mRNA Refseq: NM_001013415
• Protein Refseq: NP_001013433
• MIM: 606278
• UniProt ID: Q969H0