Recombinant Human FBXW7 Protein, GST-tagged

Cat.No. : FBXW7-3975H
Product Overview : Human FBXW7 full-length ORF (BAA91986.1, 1 a.a. - 553 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 88.7 kDa
AA Sequence : MGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXW7 F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol FBXW7
Synonyms FBXW7; F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase; F box and WD repeat domain containing 7 , F box and WD 40 domain protein 7 (archipelago homolog, Drosophila); F-box/WD repeat-containing protein 7; AGO; archipelago homolog (Drosophila); CDC4; FBW7; FBX30; FBXW6; FLJ11071; SEL 10; SEL10; archipelago; F-box protein FBW7; F-box protein FBX30; F-box protein SEL-10; homolog of C elegans sel-10; F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila); FBW6; hAgo; hCdc4; FBXO30; SEL-10; FLJ16457; DKFZp686F23254;
Gene ID 55294
mRNA Refseq NM_001013415
Protein Refseq NP_001013433
MIM 606278
UniProt ID Q969H0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FBXW7 Products

Required fields are marked with *

My Review for All FBXW7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon