Recombinant Human FBXO16 protein, GST-tagged

Cat.No. : FBXO16-301547H
Product Overview : Recombinant Human FBXO16 (186-287 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ser186-Pro287
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : SNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name FBXO16 F-box protein 16 [ Homo sapiens ]
Official Symbol FBXO16
Synonyms FBXO16; F-box protein 16; F box only protein 16; F-box only protein 16; FBX16; MGC125923; MGC125924; MGC125925;
Gene ID 157574
mRNA Refseq NM_001258211
Protein Refseq NP_001245140
MIM 608519
UniProt ID Q8IX29

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FBXO16 Products

Required fields are marked with *

My Review for All FBXO16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon