Recombinant Human FBXO16 Protein, GST-tagged

Cat.No. : FBXO16-3916H
Product Overview : Human FBXO16 partial ORF ( NP_758954, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]
Molecular Mass : 36.74 kDa
AA Sequence : MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXO16 F-box protein 16 [ Homo sapiens ]
Official Symbol FBXO16
Synonyms FBXO16; F-box protein 16; F box only protein 16; F-box only protein 16; FBX16; MGC125923; MGC125924; MGC125925;
Gene ID 157574
mRNA Refseq NM_001258211
Protein Refseq NP_001245140
MIM 608519
UniProt ID Q8IX29

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FBXO16 Products

Required fields are marked with *

My Review for All FBXO16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon