Recombinant Human FBXO11 protein, His-tagged

• Cat.No.: FBXO11-2749H
• Product Overview: Recombinant Human FBXO11 protein(858-927 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 858-927 aa
• AA Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FBXO11 F-box protein 11 [ Homo sapiens ]
• Official Symbol: FBXO11
• Synonyms: FBXO11; F-box protein 11; F box only protein 11; F-box only protein 11; FBX11; PRMT9; ubiquitin protein ligase E3 component n recognin 6; UBR6; vitiligo-associated protein 1; vitiligo-associated protein VIT-1; protein arginine N-methyltransferase 9; ubiquitin protein ligase E3 component n-recognin 6; VIT1; UG063H01; FLJ12673; MGC44383
• Gene ID: 80204
• mRNA Refseq: NM_001190274
• Protein Refseq: NP_001177203
• MIM: 607871
• UniProt ID: Q86XK2