Recombinant Human FBXO11 Protein, GST-tagged

• Cat.No.: FBXO11-3914H
• Product Overview: Human FBXO11 partial ORF ( NP_079409, 744 a.a. - 843 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It can function as an arginine methyltransferase that symmetrically dimethylates arginine residues, and it acts as an adaptor protein to mediate the neddylation of p53, which leads to the suppression of p53 function. This gene is known to be down-regulated in melanocytes from patients with vitiligo, a skin disorder that results in depigmentation. Polymorphisms in this gene are associated with chronic otitis media with effusion and recurrent otitis media (COME/ROM), a hearing loss disorder, and the knockout of the homologous mouse gene results in the deaf mouse mutant Jeff (Jf), a single gene model of otitis media. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2010]
• Molecular Mass: 36.74 kDa
• AA Sequence: KAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXO11 F-box protein 11 [ Homo sapiens ]
• Official Symbol: FBXO11
• Synonyms: FBXO11; F-box protein 11; F box only protein 11; F-box only protein 11; FBX11; PRMT9; ubiquitin protein ligase E3 component n recognin 6; UBR6; vitiligo-associated protein 1; vitiligo-associated protein VIT-1; protein arginine N-methyltransferase 9; ubiquitin protein ligase E3 component n-recognin 6; VIT1; UG063H01; FLJ12673; MGC44383
• Gene ID: 80204
• mRNA Refseq: NM_001190274
• Protein Refseq: NP_001177203
• MIM: 607871
• UniProt ID: Q86XK2