Recombinant Human FBXL18 protein, His-SUMO-tagged
Cat.No. : | FBXL18-2888H |
Product Overview : | Recombinant Human FBXL18 protein(Q96ME1)(1-365aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-365aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.2 kDa |
AA Sequence : | MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSSECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKNLLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHCLSPDSLLCR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FBXL18 F-box and leucine-rich repeat protein 18 [ Homo sapiens ] |
Official Symbol | FBXL18 |
Synonyms | FBXL18; F-box and leucine-rich repeat protein 18; F-box/LRR-repeat protein 18; Fbl18; FLJ11467; FLJ10776; FLJ26934; FLJ38075; FLJ41541; |
Gene ID | 80028 |
mRNA Refseq | NM_024963 |
Protein Refseq | NP_079239 |
MIM | 609084 |
UniProt ID | Q96ME1 |
◆ Recombinant Proteins | ||
FBXL18-3895H | Recombinant Human FBXL18 Protein, GST-tagged | +Inquiry |
FBXL18-3329Z | Recombinant Zebrafish FBXL18 | +Inquiry |
FBXL18-4956HF | Recombinant Full Length Human FBXL18 Protein, GST-tagged | +Inquiry |
FBXL18-12775H | Recombinant Human FBXL18, GST-tagged | +Inquiry |
FBXL18-2888H | Recombinant Human FBXL18 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXL18-599HCL | Recombinant Human FBXL18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXL18 Products
Required fields are marked with *
My Review for All FBXL18 Products
Required fields are marked with *
0
Inquiry Basket