Recombinant Human FBP1 Protein, His-tagged

• Cat.No.: FBP1-788H
• Product Overview: Recombinant Human FBP1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Description: Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
• Source: HEK293 cells
• Species: Human
• Tag: His
• Form: Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 1mM DTT, 10% glycerol, pH 8.0
• Molecular Mass: 37.8kD
• AA Sequence: ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQVDHHHHHH*
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: FBP1 fructose-1,6-bisphosphatase 1 [ Homo sapiens ]
• Official Symbol: FBP1
• Synonyms: FBP1; fructose-1,6-bisphosphatase 1; FBP; FBPase 1; fructose-bisphosphatase 1; growth-inhibiting protein 17; D-fructose-1,6-bisphosphate 1-phosphohydrolase 1
• Gene ID: 2203
• mRNA Refseq: NM_000507
• Protein Refseq: NP_000498
• MIM: 611570
• UniProt ID: P09467