Recombinant Human FBN1 protein(2701-2870 aa), C-His-tagged

• Cat.No.: FBN1-2737H
• Product Overview: Recombinant Human FBN1 protein(P35555)(2701-2870 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2701-2870 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: VSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLL

Gene Information

• Gene Name: FBN1 fibrillin 1 [ Homo sapiens ]
• Official Symbol: FBN1
• Synonyms: FBN1; fibrillin 1; FBN, fibrillin 1 (Marfan syndrome) , MFS1, WMS; fibrillin-1; Marfan syndrome; MASS; OCTD; SGS; fibrillin 15; FBN; WMS; MFS1; SSKS; WMS2; ACMICD; GPHYSD2
• Gene ID: 2200
• mRNA Refseq: NM_000138
• Protein Refseq: NP_000129
• MIM: 134797
• UniProt ID: P35555