Recombinant Human FASN, GST-tagged

Cat.No. : FASN-21H
Product Overview : Recombinant Human FASN(2378 a.a. - 2477 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
Molecular Mass : 36.74 kDa
AA Sequence : MEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGG AYGEDLGADYNLSQVCDGKVSVHVI
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FASN fatty acid synthase [ Homo sapiens ]
Official Symbol FASN
Synonyms FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1;
Gene ID 2194
mRNA Refseq NM_004104
Protein Refseq NP_004095
MIM 600212
UniProt ID P49327
Chromosome Location 17q25
Pathway AMPK signaling; Activation of gene expression by SREBF (SREBP); Defective AMN causes hereditary megaloblastic anemia 1
Function 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity; 3-oxoacyl-[acyl-carrier-protein] synthase activity; [acyl-carrier-protein] S-acetyltransferase activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FASN Products

Required fields are marked with *

My Review for All FASN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon