Recombinant Human FASN protein, His-tagged
Cat.No. : | FASN-2661H |
Product Overview : | Recombinant Human FASN protein(139 - 439 aa), fused to His tag, was expressed in E. coli. |
Availability | April 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 139 - 439 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FASN fatty acid synthase [ Homo sapiens ] |
Official Symbol | FASN |
Synonyms | FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1; short chain dehydrogenase/reductase family 27X, member 1; OA-519; MGC14367; MGC15706; |
Gene ID | 2194 |
mRNA Refseq | NM_004104 |
Protein Refseq | NP_004095 |
MIM | 600212 |
UniProt ID | P49327 |
◆ Recombinant Proteins | ||
Fasn-720R | Recombinant Rat Fasn Protein, His-tagged | +Inquiry |
FASN-3610H | Recombinant Human FASN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FASN-1932R | Recombinant Rat FASN Protein, His (Fc)-Avi-tagged | +Inquiry |
FASN-28809TH | Recombinant Human FASN, His-tagged | +Inquiry |
FASN-3236H | Recombinant Human FASN Protein (Met139-Glu439), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASN-597HCL | Recombinant Human FASN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FASN Products
Required fields are marked with *
My Review for All FASN Products
Required fields are marked with *
0
Inquiry Basket