Recombinant Human Fas (TNFRSF6)-associated via death domain, His-tagged
Cat.No. : | FADD-4351H |
Product Overview : | FADD produced in E.Coli is a single, non-glycosylated polypeptide chain containing 244 amino acids (1-208 a.a.) and having a molecular mass of 27.4 kDa. FADD is fused to 36 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human |
Tag : | His |
Protein Length : | 1-208 a.a. |
Description : | FADD is an adaptor protein that cooperates with a variety of cell surface receptors and mediates cell apoptotic signals. Using its C-terminal death domain, FADD is recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and consequently it take parts in the death signaling initiated by these receptors. FADD interaction with the receptors reviels the N-terminal effector domain of, which allows it to recruit caspase-8, and thus initiate the cysteine protease cascade. Knockout studies in mice furthermore propose the significance of FADD in premature T cell development. FADD plays a role in survival/proliferation and cell cycle development. FADD also takes part in cellular sublocalization, protein phosphorylation, and inhibitory molecules. |
Form : | The FADD protein solution contains 20mM Tris-HCl, pH-8, and 10% glycerol. |
Purity : | Greater than 95.0% as determined by SDS-PAGE. |
Physical Appearance : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Amino acid sequence : | MRGSHHHHHHGMASMTGGQQM GRDLYDDDDKDRWGSMDPFLVLL HSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQND LEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVI CDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN TEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWN SDAST SEAS |
Storage : | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. |
Pathways : | Apoptosis; Toll-like receptor signaling pathway; Apoptosis |
Functions : | death receptor binding; identical protein binding |
Gene Name | FADD Fas (TNFRSF6)-associated via death domain [ Homo sapiens ] |
Official Symbol | FADD |
Synonyms | FADD; Fas (TNFRSF6)-associated via death domain; GIG3; MORT1; MGC8528; Fas-associated via death domain; growth-inhibiting gene 3 protein; mediator of receptor-induced toxicity; Fas-associating protein with death domain; Fas-associating death domain-containing protein; mediator of receptor-induced toxicity; Protein FADD; Mediator of receptor induced toxicity |
Gene ID | 8772 |
mRNA Refseq | NM_003824 |
Protein Refseq | NP_003815 |
MIM | 602457 |
UniProt ID | Q13158 |
Chromosome Location | 11q13.3 |
◆ Recombinant Proteins | ||
fadD-3693E | Recombinant Escherichia coli (strain K12) fadD protein, His-tagged | +Inquiry |
FADD-28817TH | Recombinant Human FADD, His-tagged | +Inquiry |
FADD-382H | Recombinant Human FADD protein, GST-tagged | +Inquiry |
FADD-805H | Recombinant Human FADD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FADD-2352E | Recombinant Escherichia coli FADD Protein (1-561 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FADD-6473HCL | Recombinant Human FADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FADD Products
Required fields are marked with *
My Review for All FADD Products
Required fields are marked with *
0
Inquiry Basket