Recombinant Human FADD protein, GST-tagged

• Cat.No.: FADD-382H
• Product Overview: Recombinant Human FADD protein(NP_003815)(1-208 aa), fused with GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Protein length: 1-208 aa
• AA Sequence: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FADD Fas (TNFRSF6)-associated via death domain [ Homo sapiens ]
• Official Symbol: FADD
• Synonyms: FADD; Fas (TNFRSF6)-associated via death domain; protein FADD; Fas associating death domain containing protein; Fas associating protein with death domain; GIG3; growth inhibiting gene 3 protein; mediator of receptor induced toxicity; MORT1; growth-inhibiting gene 3 protein; mediator of receptor-induced toxicity; Fas-associating protein with death domain; Fas-associating death domain-containing protein; MGC8528
• Gene ID: 8772
• mRNA Refseq: NM_003824
• Protein Refseq: NP_003815
• MIM: 602457
• UniProt ID: Q13158