Recombinant Human FAM89B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM89B-4031H
• Product Overview: FAM89B MS Standard C13 and N15-labeled recombinant protein (NP_001092255) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: FAM89B (Family With Sequence Similarity 89 Member B) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include transcription corepressor binding. An important paralog of this gene is FAM89A.
• Molecular Mass: 20 kDa
• AA Sequence: MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM89B family with sequence similarity 89 member B [ Homo sapiens (human) ]
• Official Symbol: FAM89B
• Synonyms: FAM89B; family with sequence similarity 89, member B; protein FAM89B; mammary tumor virus receptor homolog 1; MTVR1
• Gene ID: 23625
• mRNA Refseq: NM_001098785
• Protein Refseq: NP_001092255
• MIM: 616128
• UniProt ID: Q8N5H3