Recombinant Human FAM89B Protein, GST-tagged

Cat.No. : FAM89B-3812H
Product Overview : Human FAM89B full-length ORF ( NP_690045.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM89B (Family With Sequence Similarity 89 Member B) is a Protein Coding gene. GO annotations related to this gene include transcription corepressor binding. An important paralog of this gene is FAM89A.
Molecular Mass : 45.1 kDa
AA Sequence : MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM89B family with sequence similarity 89, member B [ Homo sapiens ]
Official Symbol FAM89B
Synonyms FAM89B; family with sequence similarity 89, member B; protein FAM89B; mammary tumor virus receptor homolog 1; MTVR1;
Gene ID 23625
mRNA Refseq NM_001098784
Protein Refseq NP_001092254
MIM 616128
UniProt ID Q8N5H3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM89B Products

Required fields are marked with *

My Review for All FAM89B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon