Recombinant Human FAM89B Protein, GST-tagged

• Cat.No.: FAM89B-3812H
• Product Overview: Human FAM89B full-length ORF ( NP_690045.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM89B (Family With Sequence Similarity 89 Member B) is a Protein Coding gene. GO annotations related to this gene include transcription corepressor binding. An important paralog of this gene is FAM89A.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.1 kDa
• AA Sequence: MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM89B family with sequence similarity 89, member B [ Homo sapiens ]
• Official Symbol: FAM89B
• Synonyms: FAM89B; family with sequence similarity 89, member B; protein FAM89B; mammary tumor virus receptor homolog 1; MTVR1
• Gene ID: 23625
• mRNA Refseq: NM_001098784
• Protein Refseq: NP_001092254
• MIM: 616128
• UniProt ID: Q8N5H3