Recombinant Human FAM218A Protein, GST-tagged

• Cat.No.: FAM218A-5227H
• Product Overview: Human C4orf39 full-length ORF ( NP_694572.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM218A (Family With Sequence Similarity 218 Member A) is a Protein Coding gene.
• Molecular Mass: 43.4 kDa
• AA Sequence: MEGCAVRRGSCPLLPGPSAWRASPAGWAGRAKLRSWCRASGLPNRPYTLTGGRHGSVSLLRHPGTTTFVQQRSLHQSWEKRIVFSACPVSRSWCPERNFSGSIPAVTPPKLPGHSKSEGPPGKVRKRTTIRSQPLFVTRTRGFGSAVGWLPLGSPVL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM218A family with sequence similarity 218 member A [ Homo sapiens (human) ]
• Official Symbol: FAM218A
• Synonyms: FAM218A; family with sequence similarity 218 member A; C4orf39; protein FAM218A; uncharacterized protein C4orf39; Family With Sequence Similarity 218 Member A; Family With Sequence Similarity 218, Member A; Chromosome 4 Open Reading Frame 39; Uncharacterized Protein C4orf39; Protein FAM218A
• Gene ID: 152756
• mRNA Refseq: NM_153027
• Protein Refseq: NP_694572
• UniProt ID: Q96MZ4