Description :	This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide.
Source :	Wheat germ
Species :	Human
Tag :	GST
Molecular Mass :	36.74 kDa
AA Sequence :	DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVAL PWQEELCLRFMREVERLMTPEKQSS
Applications :	ELISA; WB-Re; AP; Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80oC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	FAAH fatty acid amide hydrolase [ Homo sapiens (human) ]
Official Symbol	FAAH
Synonyms	FAAH; fatty acid amide hydrolase; fatty-acid amide hydrolase 1; FAAH 1; oleamide hydrolase 1; anandamide amidohydrolase 1; FAAH-1; MGC102823; MGC138146
Gene ID	2166
mRNA Refseq	NM_001441
Protein Refseq	NP_001432
MIM	602935
UniProt ID	O00519
Chromosome Location	1p35-p34
Pathway	Retrograde endocannabinoid signaling; anandamide degradation
Function	acylglycerol lipase activity; carbon-nitrogen ligase activity, with glutamine as amido-N-donor; fatty acid amide hydrolase activity